Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310543

Solute Carrier Family 25, Member 28 (SLC25A28) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms wu:fc48b02, wu:fc66h02, zgc:64212, MFRN2, MRS3/4, MRS4L, 2210403D18Rik, Mfrn2, Mrs3/4
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310543
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC25A28 antibody: synthetic peptide directed towards the C terminal of human SLC25A28
Sequence NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQ ARVIYQIPST
Predicted Reactivity Dog : 92%, Guinea pig : 92%, Pig : 92%, Rabbit : 92%, Bovine : 85%, Rat : 85%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against SLC25A28. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SLC25A28
Background SLC25A28 is a mitochondrial iron transporter that mediates iron uptake. It is probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme.
Molecular Weight 39kDa
Gene ID 81894
NCBI Accession NP_112489, NM_031212
UniProt Q96A46
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC25A28 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives for antigen "Solute Carrier Family 25, Member 28 (SLC25A28)", type "Antibodies"
Hosts (21)
Reactivities (19), (13), (13), (13), (13), (12), (1)
Applications (12), (10), (5), (4), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1), (1), (1), (1), (1)
Beacon