Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310578

Retinal Outer Segment Membrane Protein 1 (ROM1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ROM, RP7, ROSP1, TSPAN23, M101156, Rgsc1156, Rom-1, Rosp1, Tspan23, rds35, rom, rosp1, tspan23, ROM1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310578
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ROM1 antibody: synthetic peptide directed towards the middle region of human ROM1
Sequence NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVL LEHLQDLAGT
Predicted Reactivity Human : 100%, Bovine : 92%, Mouse : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against ROM1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ROM1
Background ROM1 is an integral membrane protein found in the photoreceptor disk rim of the eye. It can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS). It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa.This gene is a member of a photoreceptor-specific gene family and encodes an integral membrane protein found in the photoreceptor disk rim of the eye. This protein can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS). It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa.
Molecular Weight 37kDa
Gene ID 6094
NCBI Accession NP_000318, NM_000327
UniProt Q03395
Research Area Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ROM1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Taylor, Noguchi, Totoki et al.: "Human chromosome 11 DNA sequence and analysis including novel gene identification." in: Nature, Vol. 440, Issue 7083, pp. 497-500, 2006 (PubMed).

Alternatives for antigen "Retinal Outer Segment Membrane Protein 1 (ROM1)", type "Antibodies"
Hosts (15), (4)
Reactivities (17), (12), (12), (12), (12), (12)
Applications (10), (8), (6), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1)
Beacon