Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310618

N-Methylpurine-DNA Glycosylase (MPG) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AAG, ADPG, APNG, CRA36.1, MDG, Mid1, PIG11, PIG16, anpg, Aag, AI326268, 9830006D05, BA3871, zgc:162984, si:xx-187g17.9, MPG, MPGR
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310618
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MPG antibody: synthetic peptide directed towards the C terminal of human MPG
Sequence LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVV DRVAEQDTQA
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%, Bovine : 84%, Rabbit : 84%, Guinea pig : 78%, Pig : 78%
Characteristics This is a rabbit polyclonal antibody against MPG. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MPG
Background MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.
Molecular Weight 32kDa
Gene ID 4350
NCBI Accession NP_001015052, NM_001015052
UniProt Q5J9I4
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MPG antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "N-Methylpurine-DNA Glycosylase (MPG)", type "Antibodies"
Hosts (22), (13), (6)
Reactivities (39), (16), (15), (12), (12)
Applications (30), (23), (14), (11), (10), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (5), (1), (1), (1), (1)
Beacon