Did you know that you can buy products from over 140 different suppliers from us?

N-Methylpurine-DNA Glycosylase (MPG) (C-Term) antibody

Details for Product No. ABIN310618
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AAG, ADPG, APNG, CRA36.1, MDG, Mid1, PIG11, PIG16, anpg, Aag, AI326268, 9830006D05, BA3871, zgc:162984, si:xx-187g17.9, MPG, MPGR
Epitope
C-Term
(11), (5), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(48), (18), (17), (12), (12)
Host
Rabbit
(26), (20), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(40), (27), (15), (11), (10), (10), (9), (4), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310618
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human MPG
Sequence LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVV DRVAEQDTQA
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rat : 100 %, Bovine : 80 %, Rabbit : 80 %, Guinea pig : 70 %, Pig : 70 %
Characteristics This is a rabbit polyclonal antibody against MPG. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MPG
Background MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.
Molecular Weight 32 kDa
Gene ID 4350
NCBI Accession NM_001015052, NP_001015052
UniProt Q5J9I4
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 293 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-N-Methylpurine-DNA Glycosylase (MPG) (C-Term) antibody WB Suggested Anti-MPG Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Hosts (26), (20), (5)
Reactivities (48), (18), (17), (12), (12)
Applications (40), (27), (15), (11), (10), (10), (9), (4), (2), (1)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (11), (5), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310618
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top