Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

N-Methylpurine-DNA Glycosylase (MPG) antibody

Antigen

N-Methylpurine-DNA Glycosylase (MPG)
Synonyms AAG, MDG, APNG, Mid1, anpg, PIG11, PIG16, CRA36.1, Aag, AI326268, 9830006D05, bY187G17.9, si:xx-187g17.9, MPG, MPGR
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN310618
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-N-Methylpurine-DNA Glycosylase (MPG) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name PIG16
Gene ID MPG
UniProt Q5J9I4
Immunogen The immunogen for anti-MPG antibody: synthetic peptide directed towards the C terminal of human MPG
Sequence LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVV DRVAEQDTQA
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-MPG antibody concentration is 1 mg/ml.
Description MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.
Characteristics Antigen Size: 293 amino acids
Molecular Weight 32kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-MPG Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "N-Methylpurine-DNA Glycosylase (MPG)", type "Antibodies"
Hosts Rabbit (30), Mouse (8), Goat (4)
Reactivities Human (40), Rat (Rattus) (23), Mouse (Murine) (22), Cow (Bovine) (19), Pig (Porcine) (18), Cat (Feline) (1), Chicken (1), Dog (Canine) (1)
Applications Western Blotting (WB) (25), Immunofluorescence (IF) (23), ELISA (20), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (10), Immunohistochemistry (IHC) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Dot Blot (DB) (2), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (3), Internal Region (1), Met10 (1)