N-Methylpurine-DNA Glycosylase (MPG) (C-Term) antibody

Details for Product No. ABIN635211
Antigen
Epitope
C-Term
13
13
3
3
2
2
2
2
2
1
1
Reactivity
Human
85
36
36
4
2
2
2
2
1
1
Host
Rabbit
67
15
7
Clonality
Polyclonal
Conjugate
Un-conjugated
3
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
72
35
24
20
13
12
6
3
1
1
Options
Immunogen MPG antibody was raised using the C terminal of MPG corresponding to a region with amino acids LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA
Specificity MPG antibody was raised against the C terminal of MPG
Purification Affinity purified
Antigen
Alternative Name MPG (MPG Antibody Abstract)
Background MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.
Molecular Weight 32 kDa (MW of target protein)
Pathways DNA Damage Repair
Application Notes WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Comment

MPG Blocking Peptide, catalog no. 33R-4919, is also available for use as a blocking control in assays to test for specificity of this MPG antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPG antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-N-Methylpurine-DNA Glycosylase (MPG) (C-Term) antibody (ABIN635211) MPG antibody used at 0.5 ug/ml to detect target protein.