Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310636

SIL1 Homolog, Endoplasmic Reticulum Chaperone (S. Cerevisiae) (SIL1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BAP, MSS, ULG5, 1810057E01Rik, AI042831, wz
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310636
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SIL1 antibody: synthetic peptide directed towards the N terminal of human SIL1
Sequence KETKAEEELDAEVLEVFHPTHEWQALQPGQAVPAGSHVRL NLQTGEREAK
Predicted Reactivity Bovine : 100%, Chicken : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Mouse : 92%, Pig : 92%, Rat : 92%, Dog : 91%, African clawed frog : 84%
Characteristics This is a rabbit polyclonal antibody against SIL1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name SIL1
Background SIL1 is a resident endoplasmic reticulum (ER), N-linked glycoprotein with an N-terminal ER targeting sequence, 2 putative N-glycosylation sites, and a C-terminal ER retention signal. This protein functions as a nucleotide exchange factor for another unfolded protein response protein. Mutations in its gene have been associated with Marinesco-Sjogren syndrome.This gene encodes a resident endoplasmic reticulum (ER), N-linked glycoprotein with an N-terminal ER targeting sequence, 2 putative N-glycosylation sites, and a C-terminal ER retention signal. This protein functions as a nucleotide exchange factor for another unfolded protein response protein. Mutations in this gene have been associated with Marinesco-Sjogren syndrome. Alternate transcriptional splice variants have been characterized.
Molecular Weight 49kDa
Gene ID 64374
NCBI Accession NP_071909, NM_022464
UniProt Q9H173
Research Area Signaling, Heat Shock Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SIL1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Anttonen, Mahjneh, Hämäläinen et al.: "The gene disrupted in Marinesco-Sjögren syndrome encodes SIL1, an HSPA5 cochaperone." in: Nature genetics, Vol. 37, Issue 12, pp. 1309-11, 2005 (PubMed).

Alternatives for antigen "SIL1 Homolog, Endoplasmic Reticulum Chaperone (S. Cerevisiae) (SIL1)", type "Antibodies"
Hosts (11), (10), (9)
Reactivities (27), (4), (1), (1)
Applications (29), (9), (9), (8), (7), (7), (2)
Epitopes (7), (5), (2), (2), (1), (1), (1)
Beacon