Amine Oxidase, Copper Containing 2 (Retina-Specific) (AOC2) (Middle Region) antibody

Details for Product No. ABIN310657
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RAO, Aoc2, Rao, aoc2, DAO2
Epitope
Middle Region
(3), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(9), (2), (2), (2), (2), (2), (2), (2)
Host
Rabbit
(6), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN310657
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human AOC2
Sequence QATMVDIHILVGKGAVQLLPGAVCVFEEAQGLPLRRHHNY LQNHFYGGLA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Pig : 90 %
Characteristics This is a rabbit polyclonal antibody against AOC2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name AOC2
Background Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes and ammonia in the presence of copper and quinone cofactor. The protein contains several conserved motifs including the active site of amine oxidases and the histidine residues that likely bind copper. It may be a critical modulator of signal transmission in retina, possibly by degrading the biogenic amines dopamine, histamine, and putrescine.Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes and ammonia in the presence of copper and quinone cofactor. This gene shows high sequence similarity to copper amine oxidases from various species ranging from bacteria to mammals. The protein contains several conserved motifs including the active site of amine oxidases and the histidine residues that likely bind copper. It may be a critical modulator of signal transmission in retina, possibly by degrading the biogenic amines dopamine, histamine, and putrescine. This gene may be a candidate gene for hereditary ocular diseases. Alternate splicing results in multiple transcript variants.
Molecular Weight 84 kDa
Gene ID 314
NCBI Accession NM_009590, NP_033720
UniProt O75106
Research Area Neurology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 756 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Amine Oxidase, Copper Containing 2 (Retina-Specific) (AOC2) (Middle Region) antibody WB Suggested Anti-AOC2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Hosts (6), (3)
Reactivities (9), (2), (2), (2), (2), (2), (2), (2)
Applications (9), (3), (1), (1)
Epitopes (3), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top