Cytochrome C Oxidase Assembly Homolog 15 (Yeast) (COX15) (N-Term) antibody

Details for Product No. ABIN310821
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CEMCOX2, wu:fa18g06, zgc:56240, zgc:77422
Epitope
N-Term
(1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
(14), (7), (7)
Host
Rabbit
(14), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(11), (8), (6), (2)
Pubmed 1 reference available
Catalog no. ABIN310821
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human COX15
Sequence DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLT EFKFIWYMEY
Predicted Reactivity Human : 100 %, Bovine : 90 %, Chicken : 90 %, Guinea pig : 90 %, Horse : 90 %, Mouse : 90 %, Rat : 90 %, Dog : 80 %, Rabbit : 80 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against COX15. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name COX15
Background Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane.Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates several transcript variants diverging in the 3' region including alternate poly A sites. In total, 2 different isoforms are encoded by these variants.
Molecular Weight 44 kDa
Gene ID 1355
NCBI Accession NM_004376, NP_004367
UniProt Q7KZN9-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 388 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Cytochrome C Oxidase Assembly Homolog 15 (Yeast) (COX15) (N-Term) antibody WB Suggested Anti-COX15 Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate
Background publications Oquendo, Antonicka, Shoubridge et al.: "Functional and genetic studies demonstrate that mutation in the COX15 gene can cause Leigh syndrome." in: Journal of medical genetics, Vol. 41, Issue 7, pp. 540-4, 2004 (PubMed).

Hosts (14), (1)
Reactivities (14), (7), (7)
Applications (11), (8), (6), (2)
Epitopes (1), (1)
back to top