Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310821

Cytochrome C Oxidase Assembly Homolog 15 (Yeast) (COX15) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CEMCOX2, wu:fa18g06, zgc:56240, zgc:77422
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310821
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-COX15 antibody: synthetic peptide directed towards the N terminal of human COX15
Sequence DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLT EFKFIWYMEY
Predicted Reactivity Human : 100%, Bovine : 92%, Chicken : 92%, Guinea pig : 92%, Horse : 92%, Mouse : 92%, Rat : 92%, Dog : 85%, Rabbit : 85%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against COX15. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name COX15
Background Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane.Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates several transcript variants diverging in the 3' region including alternate poly A sites. In total, 2 different isoforms are encoded by these variants.
Molecular Weight 44kDa
Gene ID 1355
NCBI Accession NP_004367, NM_004376
UniProt Q7KZN9-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-COX15 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oquendo, Antonicka, Shoubridge et al.: "Functional and genetic studies demonstrate that mutation in the COX15 gene can cause Leigh syndrome." in: Journal of medical genetics, Vol. 41, Issue 7, pp. 540-4, 2004 (PubMed).

Alternatives for antigen "Cytochrome C Oxidase Assembly Homolog 15 (Yeast) (COX15)", type "Antibodies"
Hosts (13), (3)
Reactivities (15), (7), (7)
Applications (12), (11), (6), (2)
Epitopes (3), (1), (1)
Beacon