Did you know that you can buy products from over 140 different suppliers from us?

FIC Domain Containing (FICD) (C-Term) antibody

Details for Product No. ABIN310856
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HIP13, HYPE, UNQ3041, D5Ertd40e, Hype
Epitope
C-Term
(3), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Fruit Fly (Drosophila melanogaster), Human
(20), (14), (14), (14), (12), (2)
Host
Rabbit
(20), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (10), (4), (4), (2), (1)
Pubmed 2 references available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310856
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human FICD
Sequence FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPIT IRKEQRSDYY
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Chicken : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against FICD. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name FICD
Background The function remains known.
Molecular Weight 52 kDa
Gene ID 11153
NCBI Accession NM_007076, NP_009007
UniProt Q9BVA6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 458 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-FIC Domain Containing (FICD) (C-Term) antibody WB Suggested Anti-FICD Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

General Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Validation Images
back to top