Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310864

FK506 Binding Protein 8, 38kDa (FKBP8) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 38kDa, FKBP-38, FKBP-8, Fkbp38, FKBP38, FKBPr38, zgc:77672, FKBP8, fkbp8
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310864
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FKBP8 antibody: synthetic peptide directed towards the N terminal of human FKBP8
Sequence GPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGD CDVIQALDLS
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Bovine : 92%
Characteristics This is a rabbit polyclonal antibody against FKBP8. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FKBP8
Background FKBP8 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, it does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, this encoded protein does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function.
Molecular Weight 45kDa
Gene ID 23770
NCBI Accession NP_036313, NM_012181
UniProt Q14318
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FKBP8 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Okamoto, Omori, Kaname et al.: "A single-amino-acid mutation in hepatitis C virus NS5A disrupting FKBP8 interaction impairs viral replication." in: Journal of virology, Vol. 82, Issue 7, pp. 3480-9, 2008 (PubMed).

Alternatives for antigen "FK506 Binding Protein 8, 38kDa (FKBP8)", type "Antibodies"
Hosts (52), (5), (2)
Reactivities (54), (33), (32), (25), (25), (12), (11), (1), (1), (1)
Applications (36), (23), (19), (7), (3), (2), (2), (1), (1), (1), (1)
Conjugates (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (8), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon