FKBP8 antibody (N-Term)

Catalog No. ABIN634523

Product Details anti-FKBP8 Antibody

Target: FKBP8 (FK506 Binding Protein 8, 38kDa (FKBP8))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FKBP8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FKBP8 antibody was raised against the N terminal of FKBP8

Purification: Affinity purified

Immunogen: FKBP8 antibody was raised using the N terminal of FKBP8 corresponding to a region with amino acids GPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FKBP8 Blocking Peptide, catalog no. 33R-3478, is also available for use as a blocking control in assays to test for specificity of this FKBP8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FKBP8

Target: FKBP8 (FK506 Binding Protein 8, 38kDa (FKBP8))

Alternative Name: FKBP8 (FKBP8 Products)

Synonyms: FKBP8 antibody, fkbp8 antibody, 38kDa antibody, FKBP-38 antibody, FKBP-8 antibody, Fkbp38 antibody, zgc:77672 antibody, FKBP38 antibody, FKBPr38 antibody, FK506 binding protein 8 antibody, FK506 binding protein 8 L homeolog antibody, FKBP8 antibody, fkbp8 antibody, Fkbp8 antibody, fkbp8.L antibody

Background: FKBP8 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, it does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: Autophagy