Did you know that you can buy products from over 140 different suppliers from us?

FK506 Binding Protein 8, 38kDa (FKBP8) (C-Term) antibody

Details for Product No. ABIN310865
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FKBP8, fkbp8, 38kDa, FKBP-38, FKBP-8, Fkbp38, zgc:77672, FKBP38, FKBPr38
Epitope
C-Term
(7), (7), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Cow (Bovine), Dog (Canine), Xenopus laevis, Human
(60), (35), (33), (25), (25), (12), (11), (1)
Host
Rabbit
(59), (3), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(5), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Application
Western Blotting (WB)
(44), (21), (19), (10), (4), (4), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310865
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human FKBP8
Sequence AIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALY RKMLGNPSRL
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Zebrafish : 100 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against FKBP8. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FKBP8
Background FKBP8 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, it does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, this encoded protein does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function.
Molecular Weight 45 kDa
Gene ID 23770
NCBI Accession NM_012181, NP_036313
UniProt Q14318
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 413 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-FK506 Binding Protein 8, 38kDa (FKBP8) (C-Term) antibody WB Suggested Anti-FKBP8 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
Background publications Okamoto, Omori, Kaname et al.: "A single-amino-acid mutation in hepatitis C virus NS5A disrupting FKBP8 interaction impairs viral replication." in: Journal of virology, Vol. 82, Issue 7, pp. 3480-9, 2008 (PubMed).

Validation Images
back to top