Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311061

Methyltransferase Like 1 (METTL1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Dmel\\CG4045, EG:22E5.4, C12orf1, TRM8, TRMT8, YDL201w, 2810012D02Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311061
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-METTL1 antibody: synthetic peptide directed towards the middle region of human METTL1
Sequence KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRV GGLVYTITDV
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against METTL1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name METTL1
Background METTL1 contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation.This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X.
Molecular Weight 34kDa
Gene ID 4234
NCBI Accession NP_005362, NM_005371
UniProt Q9UBP6
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-METTL1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Cartlidge, Knebel, Peggie et al.: "The tRNA methylase METTL1 is phosphorylated and inactivated by PKB and RSK in vitro and in cells." in: The EMBO journal, Vol. 24, Issue 9, pp. 1696-705, 2005 (PubMed).

Alternatives for antigen "Methyltransferase Like 1 (METTL1)", type "Antibodies"
Hosts (8), (1)
Reactivities (8), (2), (2)
Applications (9), (4), (2), (1)
Epitopes (2), (2), (2), (1), (1), (1)
Beacon