Did you know that you can buy products from over 140 different suppliers from us?

Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H) (N-Term) antibody

Details for Product No. ABIN311065
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RPABC3, RPB17, RPB8, RGD1561203, Polr2h, Polr2hl, POLR2H, rpb8, rpb17, hsrpb8, rpabc3
Epitope
N-Term
(9), (6), (4), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(30), (3), (3)
Host
Rabbit
(21), (10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(29), (18), (5), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN311065
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human POLR2H
Sequence DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEY VMYGKVYRIE
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Human : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against POLR2H. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name POLR2H
Background POLR2H is one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III.This gene encodes one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III.
Molecular Weight 17 kDa
Gene ID 5437
NCBI Accession NM_006232, NP_006223
UniProt P52434
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 150 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H) (N-Term) antibody WB Suggested Anti-POLR2H Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (21), (10)
Reactivities (30), (3), (3)
Applications (29), (18), (5), (2), (1)
Conjugates (2), (2), (2), (2), (2), (2)
Epitopes (9), (6), (4), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top