Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311065

Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RPABC3, RPB17, RPB8, RGD1561203, Polr2h, Polr2hl, POLR2H, rpb8, rpb17, hsrpb8, rpabc3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311065
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-POLR2H antibody: synthetic peptide directed towards the N terminal of human POLR2H
Sequence DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEY VMYGKVYRIE
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Human : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against POLR2H. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name POLR2H
Background POLR2H is one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III.This gene encodes one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III.
Molecular Weight 17kDa
Gene ID 5437
NCBI Accession NP_006223, NM_006232
UniProt P52434
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-POLR2H antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H)", type "Antibodies"
Hosts (10), (4)
Reactivities (13), (3), (3), (1), (1)
Applications (13), (6), (3), (1), (1)
Epitopes (5), (2), (1), (1)
Beacon