Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 13 (NUDT13) (N-Term) antibody

Details for Product No. ABIN311080
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933433B15Rik, si:ch211-146f4.4
Epitope
N-Term
(1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Dog (Canine), Cow (Bovine), Xenopus laevis, Human
(2)
Host
Rabbit
(2), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2), (1)
Pubmed 1 reference available
Catalog no. ABIN311080
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NUDT13
Sequence MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDAC KKAQQTGAFY
Predicted Reactivity Dog : 100 %, Human : 100 %, Bovine : 90 %, Horse : 90 %, Rabbit : 90 %, Rat : 80 %, Mouse : 70 %
Characteristics This is a rabbit polyclonal antibody against NUDT13. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NUDT13
Background NUDT13 contains 1 nudix hydrolase domain. The exact function of NUDT13 remains unknown.
Molecular Weight 40 kDa
Gene ID 25961
NCBI Accession NM_015901, NP_056985
UniProt Q86X67
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 352 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 13 (NUDT13) (N-Term) antibody WB Suggested Anti-NUDT13 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10...." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Hosts (2), (1)
Reactivities (2)
Applications (2), (1)
Epitopes (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top