Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311080

Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 13 (NUDT13) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933433B15Rik, si:ch211-146f4.4
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Dog (Canine), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311080
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NUDT13 antibody: synthetic peptide directed towards the N terminal of human NUDT13
Sequence MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDAC KKAQQTGAFY
Predicted Reactivity Dog : 100%, Human : 100%, Bovine : 92%, Horse : 92%, Rabbit : 92%, Rat : 85%, Mouse : 78%
Characteristics This is a rabbit polyclonal antibody against NUDT13. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NUDT13
Background NUDT13 contains 1 nudix hydrolase domain. The exact function of NUDT13 remains unknown.
Molecular Weight 40kDa
Gene ID 25961
NCBI Accession NP_056985, NM_015901
UniProt Q86X67
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NUDT13 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives for antigen "Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 13 (NUDT13)", type "Antibodies"
Hosts (2), (1)
Reactivities (2)
Applications (2), (2)
Epitopes (1), (1)
Beacon