Mitogen-Activated Protein Kinase Kinase 2 (MAP2K2) antibody

Antigen: Mitogen-Activated Protein Kinase Kinase 2 (MAP2K2)

Synonyms: MEK2, MKK2, MAPKK2, PRKMK2, FLJ26075

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN311108

Additional Information

Alternative name: MAPKK 2

Gene ID: MAP2K2

UniProt: P36507

Immunogen: The immunogen for anti-MAP2K2 antibody: synthetic peptide directed towards the C terminal of human MAP2K2

Sequence: IKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLN QPGTPTRTAV

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MAP2K2 antibody concentration is 1 mg/ml.

Description: MAP2K2 is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in MAP2K2 gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, mental retardation, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene.The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in this gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, mental retardation, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 400 amino acids

Molecular Weight: 44kDa

Application Details

Application Notes: WB Suggested Anti-MAP2K2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Kinases/Phosphatases

Restrictions: For Research Use only

Images

WB Suggested Anti-MAP2K2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

anti-Mitogen-Activated Protein Kinase Kinase 2 (MAP2K2) antibody (Image 2)

Publications

Product: Adjei, Cohen, Franklin et al.: "Phase I pharmacokinetic and pharmacodynamic study of the oral, small-molecule mitogen-activated protein kinase kinase 1/2 inhibitor AZD6244 (ARRY-142886) in patients with advanced cancers." in: Journal of clinical oncology : official journal of the American Society of Clinical Oncology, Vol. 26, Issue 13, pp. 2139-46, 2008 (PubMed).