Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311177

Protocadherin gamma Subfamily C, 4 (PCDHGC4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PCDH-GAMMA-C4
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311177
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PCDHGC4 antibody: synthetic peptide directed towards the N terminal of human PCDHGC4
Sequence VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPP RSGTAELRVS
Predicted Reactivity Human : 100%, Mouse : 100%
Characteristics This is a rabbit polyclonal antibody against PCDHGC4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PCDHGC4
Background PCDHGC4 is a single-pass type I membrane protein. It contains 6 cadherin domains.PCDHGC4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.
Molecular Weight 98kDa
Gene ID 56098
NCBI Accession NP_061751, NM_018928
UniProt Q9Y5F7
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PCDHGC4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wu, Zhang, Cheng et al.: "Comparative DNA sequence analysis of mouse and human protocadherin gene clusters." in: Genome research, Vol. 11, Issue 3, pp. 389-404, 2001 (PubMed).

Alternatives for antigen "Protocadherin gamma Subfamily C, 4 (PCDHGC4)", type "Antibodies"
Hosts (25), (1)
Reactivities (25), (17), (17), (17)
Applications (15), (11), (10), (6), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (1), (1), (1)
Beacon