Did you know that you can buy products from over 140 different suppliers from us?

Mdm1 Nuclear Protein Homolog (Mouse) (MDM1) (N-Term) antibody

Details for Product No. ABIN311186
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Arrd2, Mdm-1, si:ch211-266a5.6
Epitope
N-Term
(13), (8), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(20), (8), (8)
Host
Rabbit
(19), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(21), (16), (8), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN311186
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MDM1
Sequence GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISE SNVVASPEPE
Predicted Reactivity Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 90 %, Chicken : 90 %, Dog : 90 %
Characteristics This is a rabbit polyclonal antibody against MDM1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MDM1
Background MDM1 is a nuclear protein similar to the mouse double minute 1 protein. The mouse gene is located in double minute (DM) chromatin particles and is amplified in the mouse transformed 3T3 cell line, and the protein is able to bind to p53. This gene encodes a nuclear protein similar to the mouse double minute 1 protein. The mouse gene is located in double minute (DM) chromatin particles and is amplified in the mouse transformed 3T3 cell line, and the protein is able to bind to p53. In mouse several transcripts have been described for this gene which result from alternative polyadenylation, splicing and exon usage.
Molecular Weight 25 kDa
Gene ID 56890
NCBI Accession NM_020128, NP_064513
UniProt B2RB22
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 222 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Mdm1 Nuclear Protein Homolog (Mouse) (MDM1) (N-Term) antibody WB Suggested Anti-MDM1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311186
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top