Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311188

Family with Sequence Similarity 20, Member C (FAM20C) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DMP-4, DMP4, GEF-CK, RNS, C76981, mKIAA4081, RGD1311980
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311188
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM20C antibody: synthetic peptide directed towards the middle region of human FAM20C
Sequence CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRK TWRNPWRRSY
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%
Characteristics This is a rabbit polyclonal antibody against FAM20C. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FAM20C
Background FAM20C belongs to the FAM20 family. FAM20C is a calcium-binding protein which may play a role in dentin mineralization. Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine Syndrome), highlighting a crucial molecule in bone development.
Molecular Weight 66kDa
Gene ID 56975
NCBI Accession NP_064608, NM_020223
UniProt Q8IXL6
Research Area Organogenesis, Extracellular Matrix
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM20°Cantibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Simpson, Hsu, Keir et al.: "Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine syndrome), highlighting a crucial molecule in bone development." in: American journal of human genetics, Vol. 81, Issue 5, pp. 906-12, 2007 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 20, Member C (FAM20C)", type "Antibodies"
Hosts (22)
Reactivities (20), (13), (13), (13), (13), (12), (1)
Applications (13), (10), (6), (5), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (4), (1)
Beacon