Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311202

Neuroligin 4, X-Linked (NLGN4X) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ASPGX2, AUTSX2, HLNX, HNL4X, NLGN4, NL-4, NL4, Nlgn4, Nlgn4x, nlgn4, NLGN4X
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311202
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NLGN4X antibody: synthetic peptide directed towards the middle region of human NLGN4X
Sequence ELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTK FIHTKPNRFE
Predicted Reactivity Chicken : 100%, Horse : 100%, Pig : 100%
Characteristics This is a rabbit polyclonal antibody against NLGN4X. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NLGN4X
Background NLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs, large (Drosophila) homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. Two transcript variants encoding the same protein have been identified for this gene.
Molecular Weight 92kDa
Gene ID 57502
NCBI Accession NP_065793, NM_020742
UniProt Q8NFZ3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NLGN4X antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wermter, Kamp-Becker, Strauch et al.: "No evidence for involvement of genetic variants in the X-linked neuroligin genes NLGN3 and NLGN4X in probands with autism spectrum disorder on high functioning level." in: American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics, Vol. 147B, Issue 4, pp. 535-7, 2008 (PubMed).

Alternatives for antigen "Neuroligin 4, X-Linked (NLGN4X)", type "Antibodies"
Hosts (26), (4), (3), (1)
Reactivities (31), (19), (18), (18), (17), (2), (1), (1), (1)
Applications (18), (15), (10), (10), (3), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (2), (2), (2)
Beacon