Potassium Channel, Subfamily K, Member 4 (KCNK4) antibody

Antigen: Potassium Channel, Subfamily K, Member 4 (KCNK4)

Synonyms: TRAAK, K2p4.1, TRAAK1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human

Application: Western Blotting (WB)

Catalog no.: ABIN311258

Additional Information

Alternative name: KCNK4

Gene ID: KCNK4

UniProt: Q9NYG8

Immunogen: The immunogen for anti-KCNK4 antibody: synthetic peptide directed towards the N terminal of human KCNK4

Sequence: ELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPET NSTSNSSHSA

Cross-Reactivity: Cow (Bovine), Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-KCNK4 antibody concentration is 1 mg/ml.

Description: Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. KCNK4 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. It homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids.Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The encoded protein homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 393 amino acids

Molecular Weight: 43kDa

Application Details

Application Notes: WB Suggested Anti-KCNK4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Neurology

Restrictions: For Research Use only

Images

WB Suggested Anti-KCNK4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).