KCNK4 antibody (N-Term)

Catalog No. ABIN633765

Product Details anti-KCNK4 Antibody

Target: KCNK4 (Potassium Channel, Subfamily K, Member 4 (KCNK4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNK4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNK4 antibody was raised against the N terminal of KCNK4

Purification: Affinity purified

Immunogen: KCNK4 antibody was raised using the N terminal of KCNK4 corresponding to a region with amino acids MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNK4 Blocking Peptide, catalog no. 33R-6385, is also available for use as a blocking control in assays to test for specificity of this KCNK4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNK4

Target: KCNK4 (Potassium Channel, Subfamily K, Member 4 (KCNK4))

Alternative Name: KCNK4 (KCNK4 Products)

Synonyms: K2p4.1 antibody, TRAAK antibody, TRAAK1 antibody, MLZ-622 antibody, TRAAKt antibody, Tex40 antibody, KT4.1 antibody, potassium two pore domain channel subfamily K member 4 antibody, potassium channel, subfamily K, member 4 antibody, KCNK4 antibody, Kcnk4 antibody

Background: Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. KCNK4 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. It homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids.

Molecular Weight: 43 kDa (MW of target protein)