Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311273

Monoacylglycerol O-Acyltransferase 1 (MOGAT1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MGAT1, DGAT2L, DGAT2L1, mogat2-a, 0610030A14Rik, 1110064N14Rik, Dgat2l, Dgat2l1, mDC2, dgat2l1, mogat1, zgc:171525
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311273
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MOGAT1 antibody: synthetic peptide directed towards the C terminal of human MOGAT1
Sequence PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIP EHETLVLK
Predicted Reactivity Mouse : 100%, Pig : 100%, Rabbit : 100%, Chicken : 92%, Dog : 92%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against MOGAT1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MOGAT1
Background Acyl-CoA:monoacylglycerol acyltransferase (MOGAT, EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids.Acyl-CoA:monoacylglycerol acyltransferase (MOGAT, EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids (Yen et al., 2002 [PubMed 12077311]).
Molecular Weight 39kDa
Gene ID 116255
NCBI Accession NP_477513, NM_058165
UniProt Q96PD6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MOGAT1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives for antigen "Monoacylglycerol O-Acyltransferase 1 (MOGAT1)", type "Antibodies"
Hosts (9), (2)
Reactivities (10), (2), (2)
Applications (10), (4), (4), (3), (3), (2)
Epitopes (5), (2), (2), (2)
Beacon