EMI Domain Containing 1 (EMID1) (C-Term) antibody

Details for Product No. ABIN311284
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms AW122071, CO-5, Emu1, EMI5, EMU1, RGD1565846
Epitope
C-Term
(2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(4)
Host
Rabbit
(5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5)
Pubmed 1 reference available
Catalog no. ABIN311284
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human EMID1
Sequence TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVA PRSRDERG
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Guinea pig : 90 %, Pig : 90 %
Characteristics This is a rabbit polyclonal antibody against EMID1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EMID1
Background EMID1 contains 1 collagen-like domain and 1 EMI domain. The exact function of EMID1 remains unknown.
Molecular Weight 45 kDa
Gene ID 129080
NCBI Accession NM_133455, NP_597712
UniProt Q96A84
Research Area Signaling, Extracellular Matrix
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 443 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-EMI Domain Containing 1 (EMID1) (C-Term) antibody WB Suggested Anti-EMID1 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Hosts (5)
Reactivities (4)
Applications (5)
Epitopes (2), (2), (1), (1)
back to top