Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311284

EMI Domain Containing 1 (EMID1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AW122071, CO-5, Emu1, EMI5, EMU1, RGD1565846
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311284
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EMID1 antibody: synthetic peptide directed towards the C terminal of human EMID1
Sequence TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVA PRSRDERG
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Guinea pig : 92%, Pig : 91%
Characteristics This is a rabbit polyclonal antibody against EMID1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name EMID1
Background EMID1 contains 1 collagen-like domain and 1 EMI domain. The exact function of EMID1 remains unknown.
Molecular Weight 45kDa
Gene ID 129080
NCBI Accession NP_597712, NM_133455
UniProt Q96A84
Research Area Signaling, Extracellular Matrix
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EMID1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "EMI Domain Containing 1 (EMID1)", type "Antibodies"
Hosts (5)
Reactivities (4)
Applications (5), (1)
Epitopes (3), (2), (1), (1)
Beacon