Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 780B (ZNF780B) (N-Term) antibody

Details for Product No. ABIN311287
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF779
Epitope
N-Term
(11), (8), (2)
Reactivity
Human
(13)
Host
Rabbit
(13)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (7)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311287
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF780B
Sequence RWYPDLESKYGPEKISPENDIFEINLPKHVIKQISKTLGL EAFYFRNDSE
Predicted Reactivity Human :100 %,   Sorghum :70 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF780B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF780B
Background ZNF780B belongs to the krueppel C2H2-type zinc-finger protein family. It contains 23 C2H2-type zinc fingers and 1 KRAB domain. ZNF780B may be involved in transcriptional regulation.
Molecular Weight 97 kDa
Gene ID 163131
NCBI Accession NM_001005851, NP_001005851
UniProt Q9Y6R6
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 833 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 780B (ZNF780B) (N-Term) antibody WB Suggested Anti-ZNF780B Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Validation Images
back to top