Septin 9 (SEPT9) (C-Term) antibody

Details for Product No. ABIN311460
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms AF17q25, MSF, MSF1, NAPB, PNUTL4, SINT1, SeptD1, septin-9, Msf, Sint1, Slpa, Eseptin, msf, cb999, sept9, fb02h06, wu:fb02h06, SEPT9, msf1, napb, sint1, pnutl4, septd1, af17q25
Epitope
C-Term
(2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(8), (2), (2), (1)
Host
Rabbit
(14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1)
Application
Western Blotting (WB)
(8), (3), (3), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN311460
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human SEPT9(septin 9)
Sequence HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGS SAMANGMEEK
Predicted Reactivity Mouse :100 %,   Rat :100 %,   Crab-eating macaque :100 %,   Chicken :100 %,   Human :100 %,   Western clawed frog :90 %,   African clawed frog :90 %,   Green puffer :70 %,   Zebrafish :70 %,  
Characteristics This is a rabbit polyclonal antibody against SEPT9. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SEPT9(septin 9)
Background Septin-9 is a member of the septin family, which contains cytoplasmic cytoskeletal filament-forming proteins that have a conserved GTP-binding domain.Septin-9 is a member of the septin family, which contains cytoplasmic cytoskeletal filament-forming proteins that have a conserved GTP-binding domain (Osaka et al., 1999 [PubMed 10339604]).
Molecular Weight 37 kDa
Gene ID 10801
NCBI Accession NM_001113496, NP_001106968
UniProt Q9UHD8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 335 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Septin 9 (SEPT9) (C-Term) antibody WB Suggested Anti-SEPT9(septin 9) Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Product cited in: Sudo, Ito, Iwamoto et al.: "SEPT9 sequence alternations causing hereditary neuralgic amyotrophy are associated with altered interactions with SEPT4/SEPT11 and resistance to Rho/Rhotekin-signaling." in: Human mutation, Vol. 28, Issue 10, pp. 1005-13, 2007 (PubMed).

Hosts (14)
Reactivities (8), (2), (2), (1)
Applications (8), (3), (3), (2), (1), (1)
Conjugates (1), (1)
Epitopes (2), (1), (1), (1)
back to top