Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311460

Septin 9 (SEPT9) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AF17q25, MSF, MSF1, NAPB, PNUTL4, SINT1, SeptD1, septin-9, Msf, Sint1, Slpa, Eseptin, msf, cb999, sept9, fb02h06, wu:fb02h06, SEPT9, msf1, napb, sint1, pnutl4, septd1, af17q25
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311460
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SEPT9(septin 9) antibody: synthetic peptide directed towards the C terminal of human SEPT9(septin 9)
Sequence HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGS SAMANGMEEK
Predicted Reactivity Mouse :100%,   Rat :100%,   Crab-eating macaque :100%,   Chicken :100%,   Human :100%,   Western clawed frog :92%,   African clawed frog :92%,   Green puffer :75%,   Zebrafish :75%,  
Characteristics This is a rabbit polyclonal antibody against SEPT9. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SEPT9(septin 9)
Background Septin-9 is a member of the septin family, which contains cytoplasmic cytoskeletal filament-forming proteins that have a conserved GTP-binding domain.Septin-9 is a member of the septin family, which contains cytoplasmic cytoskeletal filament-forming proteins that have a conserved GTP-binding domain (Osaka et al., 1999 [PubMed 10339604]).
Molecular Weight 37kDa
Gene ID 10801
NCBI Accession NP_001106968, NM_001113496
UniProt Q9UHD8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SEPT9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Sudo, Ito, Iwamoto et al.: "SEPT9 sequence alternations causing hereditary neuralgic amyotrophy are associated with altered interactions with SEPT4/SEPT11 and resistance to Rho/Rhotekin-signaling." in: Human mutation, Vol. 28, Issue 10, pp. 1005-13, 2007 (PubMed).

Alternatives for antigen "Septin 9 (SEPT9)", type "Antibodies"
Hosts (15), (4)
Reactivities (13), (3), (2), (1)
Applications (13), (6), (3), (2), (2), (1), (1), (1)
Conjugates (1), (1)
Epitopes (2), (2), (1), (1), (1), (1)
Beacon