DPH1 / OVAC1 antibody

Antigen: DPH1 / OVAC1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish, Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN311480

Additional Information

Gene ID: DPH1

UniProt: Q9BZG8

Immunogen: The immunogen for anti-DPH1 antibody: synthetic peptide directed towards the middle region of human DPH1

Sequence: RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLES RLRALGLSFV

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-DPH1 antibody concentration is 1 mg/ml.

Description: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2, MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]). Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2, MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-40 AF321876.1 1-40 41-1028 BC003099.1 3-990 1029-1410 BP417755.1 78-459 1411-2188 AK090530.1 1484-2261 2189-2200 AF321876.1 2189-2200

Characteristics: Antigen Size: 443 amino acids

Molecular Weight: 49kDa

Application Details

Application Notes: WB Suggested Anti-DPH1 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-DPH1 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate

Publications

Product: Liu, Milne, Kuremsky et al.: "Identification of the proteins required for biosynthesis of diphthamide, the target of bacterial ADP-ribosylating toxins on translation elongation factor 2." in: Molecular and cellular biology, Vol. 24, Issue 21, pp. 9487-97, 2004 (PubMed).