DPH1 antibody

Catalog No. ABIN632695

Product Details anti-DPH1 Antibody

Target: DPH1 (DPH1 Homolog (DPH1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DPH1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DPH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DPH1 Blocking Peptide, catalog no. 33R-8068, is also available for use as a blocking control in assays to test for specificity of this DPH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DPH1

Target: DPH1 (DPH1 Homolog (DPH1))

Alternative Name: DPH1 (DPH1 Products)

Synonyms: DPH1 antibody, DPH1-OVCA2 antibody, dph1-ovca2 antibody, dph2l antibody, dph2l1 antibody, ovca1 antibody, DPH2L antibody, DPH2L1 antibody, OVCA1 antibody, zgc:110702 antibody, 2310011M22Rik antibody, 4930488F09Rik antibody, AW551873 antibody, Dph2l1 antibody, Ovca1 antibody, RGD1562694 antibody, diphthamide biosynthesis 1 antibody, diphthamide biosynthesis protein 1 antibody, diphthamide biosynthesis 1 L homeolog antibody, 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 antibody, DPH1 antibody, NCU08503 antibody, ATEG_01183 antibody, LELG_00973 antibody, HCAG_03806 antibody, AOR_1_728014 antibody, PTRG_05729 antibody, CTRG_01524 antibody, UREG_06411 antibody, BDBG_05574 antibody, MCYG_04396 antibody, PITG_12187 antibody, MGYG_02224 antibody, LOC100284663 antibody, dph1.L antibody, dph1 antibody, Dph1 antibody, dph-1 antibody

Background: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2.

Molecular Weight: 49 kDa (MW of target protein)