Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3) antibody

Antigen: Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3)

Synonyms: ARC21, p21-Arc, 21kDa, p21-Ar, p21Arc, AA408672, AI788639, 1110006A04Rik, MGC68983, MGC127675, arc21, p21-arc

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Chicken, Pig (Porcine), Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN311489

Additional Information

Alternative name: ARPC3 / ARC21

Gene ID: ARPC3

UniProt: O15145

Immunogen: The immunogen for anti-ARPC3 antibody: synthetic peptide directed towards the N terminal of human ARPC3

Sequence: MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTD IVDEAIYYFK

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ARPC3 antibody concentration is 1 mg/ml.

Description: ARPC3 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein, the p21 subunit, has yet to be determined.This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p21 subunit, has yet to be determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 178 amino acids

Molecular Weight: 20kDa

Application Details

Application Notes: WB Suggested Anti-ARPC3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ARPC3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).