Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311527

Dual Specificity Phosphatase 19 (DUSP19) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SKRP1, C79103, TS-DSP1, 5930436K22Rik, DUSP17, LMWDSP3, Dusp19, skrp1, dusp17, ts-dsp1, MGC85046, si:dkey-237j22.1, DKFZp469B171
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311527
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DUSP19 antibody: synthetic peptide directed towards the C terminal of human DUSP19
Sequence SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESN KCDRIQENSS
Predicted Reactivity Bovine : 92%, Guinea pig : 92%, Horse : 92%, Mouse : 92%, Dog : 85%, Rat : 84%
Characteristics This is a rabbit polyclonal antibody against DUSP19. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DUSP19
Background DUSP19 belongs to the protein-tyrosine phosphatase family, non-receptor class dual specificity subfamily. It contains 1 tyrosine-protein phosphatase domain. DUSP19 has a dual specificity toward Ser/Thr and Tyr-containing proteins.
Molecular Weight 24kDa
Gene ID 142679
NCBI Accession NP_543152, NM_080876
UniProt Q8WTR2
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DUSP19 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives for antigen "Dual Specificity Phosphatase 19 (DUSP19)", type "Antibodies"
Hosts (21), (2)
Reactivities (20), (5), (2)
Applications (21), (11), (9), (3), (2), (2)
Epitopes (3), (2), (1), (1), (1), (1), (1)
Beacon