Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311574

DnaJ (Hsp40) Homolog, Subfamily C, Member 24 (DNAJC24) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DPH4, JJJ3, ZCSL3, 1700030A21Rik, 2610027M02Rik, AV066965, AW240712, Dph4, MmDjC7, Zcsl3, RGD1564710
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311574
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DPH4 antibody: synthetic peptide directed towards the N terminal of human DPH4
Sequence MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHP DKQSTDVPAG
Predicted Reactivity Human :100%,   Mouse :92%,   Bovine :85%,  
Characteristics This is a rabbit polyclonal antibody against DPH4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DPH4
Background Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2, MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2.Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2, MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).
Molecular Weight 17kDa
Gene ID 120526
NCBI Accession NP_859057, NM_181706
UniProt Q6P3W2
Research Area Signaling, Metabolism, Heat Shock Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DPH4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Liu, Milne, Kuremsky et al.: "Identification of the proteins required for biosynthesis of diphthamide, the target of bacterial ADP-ribosylating toxins on translation elongation factor 2." in: Molecular and cellular biology, Vol. 24, Issue 21, pp. 9487-97, 2004 (PubMed).

Alternatives for antigen "DnaJ (Hsp40) Homolog, Subfamily C, Member 24 (DNAJC24)", type "Antibodies"
Hosts (9)
Reactivities (8), (2), (2)
Applications (9), (5)
Epitopes (2), (2), (2), (2), (1), (1)
Beacon