Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311621

Heat Shock 70kDa Protein 4-Like (HSPA4L) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms APG-1, HSPH3, Osp94, 94kDa, AI461691, OSP94
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311621
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HSPA4L antibody: synthetic peptide directed towards the C terminal of human HSPA4L
Sequence KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLT QDPVVKVSEI
Predicted Reactivity Human : 100%, Guinea pig : 92%, Mouse : 92%, Pig : 92%, Rabbit : 92%, Rat : 92%, Dog : 85%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against HSPA4L. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HSPA4L
Background HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.
Molecular Weight 92kDa
Gene ID 22824
NCBI Accession NP_055093, NM_014278
UniProt O95757
Research Area Signaling, Heat Shock Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HSPA4L antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Heat Shock 70kDa Protein 4-Like (HSPA4L)", type "Antibodies"
Hosts (9), (8)
Reactivities (14), (1)
Applications (10), (10), (5), (3), (3)
Epitopes (8), (2), (1), (1), (1)
Beacon