Sperm Associated Antigen 11B (SPAG11B) antibody

Antigen: Sperm Associated Antigen 11B (SPAG11B)

Synonyms: Bin1b, Spag11, EP2, HE2, EP2C, EP2D, HE2C, EDDM2B, SPAG11, MGC61846, Ep2c/h, EG546038, Spag11c/h, SPAG11B, EDDM2A

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN311630

Additional Information

Alternative name: SPAG11B / EP2

Gene ID: SPAG11B

UniProt: Q08648-3

Immunogen: The immunogen for anti-SPAG11B antibody: synthetic peptide directed towards the N terminal of human SPAG11B

Sequence: MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELR ERAPGQGTNG

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SPAG11B antibody concentration is 1 mg/ml.

Description: SPAG11B is one of several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides.This gene encodes several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative splicing of this gene results in seven transcript variants encoding different isoforms. Two different N-terminal and five different C-terminal protein sequences are encoded by the splice variants. Two additional variants have been described, but their full length sequences have not been determined.

Characteristics: Antigen Size: 133 amino acids

Molecular Weight: 15kDa

Application Details

Application Notes: WB Suggested Anti-SPAG11B Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SPAG11B Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle

Publications

Product: Avellar, Honda, Hamil et al.: "Differential expression and antibacterial activity of epididymis protein 2 isoforms in the male reproductive tract of human and rhesus monkey (Macaca mulatta)." in: Biology of reproduction, Vol. 71, Issue 5, pp. 1453-60, 2004 (PubMed).