SPAG11B antibody (N-Term)

Catalog No. ABIN633893

Product Details anti-SPAG11B Antibody

Target: SPAG11B (Sperm Associated Antigen 11B (SPAG11B))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPAG11B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SPAG11 B antibody was raised against the N terminal of SPAG11

Purification: Affinity purified

Immunogen: SPAG11 B antibody was raised using the N terminal of SPAG11 corresponding to a region with amino acids MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPAG11B Blocking Peptide, catalog no. 33R-6377, is also available for use as a blocking control in assays to test for specificity of this SPAG11B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPAG10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPAG11B

Target: SPAG11B (Sperm Associated Antigen 11B (SPAG11B))

Alternative Name: SPAG11B (SPAG11B Products)

Synonyms: EDDM2B antibody, EP2 antibody, EP2C antibody, EP2D antibody, HE2 antibody, HE2C antibody, SPAG11 antibody, Bin1b antibody, Spag11 antibody, Ep2c/h antibody, EG546038 antibody, Spag11c/h antibody, SPAG11B antibody, 9230111C08Rik antibody, EP2Q antibody, EP2e antibody, sperm associated antigen 11B antibody, sperm associated antigen 11A antibody, SPAG11B antibody, Spag11a antibody, Spag11b antibody

Background: SPAG11B is one of several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides.

Molecular Weight: 15 kDa (MW of target protein)