Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311703

Transmembrane Protein 184A (TMEM184A) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Sdmg1, RGD1306702
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311703
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMEM184A antibody: synthetic peptide directed towards the C terminal of human TMEM184A
Sequence CQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIH NFSPAYQHYT
Predicted Reactivity Dog : 92%, Guinea pig : 85%, Horse : 78%, Pig : 78%
Characteristics This is a rabbit polyclonal antibody against TMEM184A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMEM184A
Background TMEM184A is a multi-pass membrane proteinPotential. It belongs to the UPF0206 family. The exact function of TMEM184A remains unknown.
Molecular Weight 46kDa
Gene ID 202915
NCBI Accession NP_001091089, NM_001097620
UniProt Q6ZMB5
Research Area Reproduction
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMEM184A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives for antigen "Transmembrane Protein 184A (TMEM184A)", type "Antibodies"
Hosts (11)
Reactivities (10), (8), (8)
Applications (11), (10), (5), (4)
Epitopes (9)
Beacon