Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404803

Sirtuin 4 (SIRT4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SIR2L4, 4930596O17Rik, SIRT4, im:7139453
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN404803
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SIRT4 antibody: synthetic peptide directed towards the N terminal of human SIRT4
Sequence ASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDY RSEKVGLYAR
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Sheep : 100%
Characteristics This is a rabbit polyclonal antibody against SIRT4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SIRT4
Background SIRT4 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT4 is included in class IV of the sirtuin family. This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family.
Molecular Weight 35kDa
Gene ID 23409
NCBI Accession NP_036372, NM_012240
UniProt Q9Y6E7
Research Area Chromatin and Nuclear Signaling, Metabolism, Proteases
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SIRT4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ahuja, Schwer, Carobbio et al.: "Regulation of insulin secretion by SIRT4, a mitochondrial ADP-ribosyltransferase." in: The Journal of biological chemistry, Vol. 282, Issue 46, pp. 33583-92, 2007 (PubMed).

Alternatives for antigen "Sirtuin 4 (SIRT4)", type "Antibodies"
Hosts (34), (10), (9), (4)
Reactivities (48), (33), (31), (14), (14), (2)
Applications (45), (31), (13), (9), (7), (4), (4), (1), (1), (1), (1)
Conjugates (5), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (13), (6), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon