Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404815

Homeobox C10 (HOXC10) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HOX3I, Hox-3.6, AI506621, XHoxc10, MGC80182, HOXC10, HOXD10
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN404815
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HOXC10 antibody: synthetic peptide directed towards the N terminal of human HOXC10
Sequence GSDFNCGVMRGCGLAPSLSKRDEGSSPSLALNTYPSYLSQ LDSWGDPKAA
Predicted Reactivity Human : 100%, Dog : 85%, Mouse : 85%, Rabbit : 85%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against HOXC10. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HOXC10
Background HOXC10 belongs to the homeobox family. The homeobox family is a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation.
Molecular Weight 38kDa
Gene ID 3226
NCBI Accession NP_059105, NM_017409
UniProt Q9NYD6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HOXC10 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zhai, Kuick, Nan et al.: "Gene expression analysis of preinvasive and invasive cervical squamous cell carcinomas identifies HOXC10 as a key mediator of invasion." in: Cancer research, Vol. 67, Issue 21, pp. 10163-72, 2007 (PubMed).

Alternatives for antigen "Homeobox C10 (HOXC10)", type "Antibodies"
Hosts (16), (8), (1)
Reactivities (25), (8), (3), (3)
Applications (23), (11), (7), (4), (2), (2)
Epitopes (5), (4), (3), (3), (2), (2), (2), (2), (1), (1), (1)
Beacon