Hypoxia Inducible Factor 1, alpha Subunit Inhibitor (HIF1AN) antibody
| Antigen | Hypoxia Inducible Factor 1, alpha Subunit Inhibitor (HIF1AN) |
| Synonyms | HIF1, MOP1, PASD8, bHLHe78, HIF-1alpha, HIF1-ALPHA, FIH1, FLJ20615, FLJ22027, DKFZp762F1811, 2310046M24Rik, A830014H24Rik, HIF1A, HIF-1a, HIF1a, hif-1a, hif1a |
| Clonality | Polyclonal |
| Host |
Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Xenopus laevis |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB) |
![]() |
1 reference available |
| Catalog no. | ABIN404835 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | HIF1AN / FIH1 |
| Gene ID | HIF1AN |
| UniProt | Q9NWT6 |
| Immunogen | The immunogen for anti-HIF1AN antibody: synthetic peptide directed towards the middle region of human HIF1AN |
| Sequence | TSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPD QFECLYPYPV |
| Cross-Reactivity | Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-HIF1AN antibody concentration is 1 mg/ml. |
| Description | HIF1AN is a co-repressor that interacts with hypoxia-inducible factor 1 (HIF-1) alpha and the von Hippel-Lindau tumor suppressor protein to mediate repression of HIF-1 transcriptional activity. |
| Characteristics | Antigen Size: 349 amino acids |
| Molecular Weight | 40kDa |
Application Details
| Application Notes |
WB Suggested Anti-HIF1AN Antibody Titration: 0.2-1 ug/ml Positive Control: Human heart. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Publications
| Product |
Linke, Stojkoski, Kewley et al.: "Substrate requirements of the oxygen-sensing asparaginyl hydroxylase factor-inhibiting hypoxia-inducible factor." in: The Journal of biological chemistry, Vol. 279, Issue 14, pp. 14391-7, 2004 (PubMed).
|
Alternatives
Alternatives for antigen "Hypoxia Inducible Factor 1, alpha Subunit Inhibitor (HIF1AN)", type "Antibodies"
| Hosts | Rabbit (45), Mouse (4) |
| Reactivities | Human (50), Mouse (Murine) (26), Rat (Rattus) (25), Cow (Bovine) (21), Dog (Canine) (21), Chicken (19), Pig (Porcine) (18), Cat (Feline) (1), Xenopus laevis (1), Zebrafish (1) |
| Applications | Western Blotting (WB) (31), ELISA (20), Immunofluorescence (IF) (17), Immunohistochemistry (IHC) (7), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoprecipitation (IP) (3), Flow Cytometry (FACS) (2), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1) |
| Conjugates | Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1) |
| Epitopes | N-Term (7), C-Term (5), Internal Region (2), Middle Region (1) |




Alternatives