Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404981

Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 3 (KCNC3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KV3.3, SCA13, KSHIIID, kcnc1, kshiiid, kv3.3, sca13, KShIIID, Kcr2-3, Kv3.3, kcnc3-A, Kv3.1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN404981
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KCNC3 antibody: synthetic peptide directed towards the middle region of human KCNC3
Sequence YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYG DMYPKTWSGM
Predicted Reactivity Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%
Characteristics This is a rabbit polyclonal antibody against KCNC3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KCNC3
Background The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. KCNC3 belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.
Molecular Weight 80kDa
Gene ID 3748
NCBI Accession NP_004968, NM_004977
UniProt Q14003
Research Area Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KCNC3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Waters, Minassian, Stevanin et al.: "Mutations in voltage-gated potassium channel KCNC3 cause degenerative and developmental central nervous system phenotypes." in: Nature genetics, Vol. 38, Issue 4, pp. 447-51, 2006 (PubMed).

Alternatives for antigen "Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 3 (KCNC3)", type "Antibodies"
Hosts (28), (12), (6)
Reactivities (39), (19), (16), (12), (12), (12), (2)
Applications (37), (28), (10), (7), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (6), (5), (4), (2), (2), (1), (1), (1)
Beacon