Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405019

Sex Comb On Midleg-Like 1 (Drosophila) (SCML1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN405019
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SCML1 antibody: synthetic peptide directed towards the middle region of human SCML1
Sequence ESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPI LSRTPSPVHP
Predicted Reactivity Human : 100%, Pig : 85%
Characteristics This is a rabbit polyclonal antibody against SCML1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SCML1
Background The function of SCML1 remains unknown.
Molecular Weight 34kDa
Gene ID 6322
NCBI Accession NP_006737, NM_006746
UniProt Q5H968
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SCML1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives for antigen "Sex Comb On Midleg-Like 1 (Drosophila) (SCML1)", type "Antibodies"
Hosts (14), (9)
Reactivities (23)
Applications (20), (11), (5), (3), (3), (2), (1)
Epitopes (7), (3), (2), (2), (2), (1), (1)
Beacon