Zinc Finger Protein 197 (ZNF197) (N-Term) antibody

Details for Product No. ABIN405021
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF197, D3S1363E, P18, VHLaK, ZKSCAN9, ZNF166, ZNF20, ZSCAN41
Epitope
N-Term
(12), (8), (2), (1), (1), (1)
Reactivity
Cow (Bovine), Dog (Canine), Human
(17), (2), (1)
Host
Rabbit
(15), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(17), (10), (8), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405021
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF197
Sequence MTRENVAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWET SHLHFRQLRY
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Dog : 90 %
Characteristics This is a rabbit polyclonal antibody against ZNF197. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF197
Background ZNF197 belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene is located in a cluster of zinc finger genes at 3p21. Two alternatively spliced transcripts encoding different isoforms have been described.
Molecular Weight 30 kDa
Gene ID 10168
NCBI Accession NM_001024855, NP_001020026
UniProt Q86VG0
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 267 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Li, Wang, Na et al.: "The VHL protein recruits a novel KRAB-A domain protein to repress HIF-1alpha transcriptional activity." in: The EMBO journal, Vol. 22, Issue 8, pp. 1857-67, 2003 (PubMed).

Validation Images
back to top