Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

TAR DNA Binding Protein (TARDBP) antibody

Antigen

TAR DNA Binding Protein (TARDBP)

Synonyms ALS10, TDP-43, Tdp43, C85084, 1190002A23Rik, fb77f02, fc52g10, wu:fb77f02, wu:fc52g10, tardbp, MGC53141, TARDBP, TDP43, DKFZp459I2127, MGC129120
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN405024
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name TARDBP
Gene ID TARDBP
UniProt Q13148
Immunogen The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the middle region of human TARDBP
Sequence GISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGN SRGGGAGLGN
Cross-Reactivity Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-TARDBP antibody concentration is 1 mg/ml.
Description HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARDBP is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription.HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Characteristics Antigen Size: 414 amino acids
Molecular Weight 45kDa

Application Details

Application Notes WB Suggested Anti-TARDBP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Muscle.
Immunohistochemistry with Thymus tissue at an antibody concentration of 5µg/ml using anti-TARDBP antibody (ABIN405024).
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors, DNA/RNA, Hormones, Cytokines
Restrictions For Research Use only

Publications

Product Kabashi, Valdmanis, Dion et al.: "TARDBP mutations in individuals with sporadic and familial amyotrophic lateral sclerosis." in: Nature genetics, Vol. 40, Issue 5, pp. 572-4, 2008 (PubMed).

Alternatives

Alternatives for antigen "TAR DNA Binding Protein (TARDBP)", type "Antibodies"
Hosts Rabbit (60), Mouse (22), Goat (5), Rat (1)
Reactivities Human (83), Rat (Rattus) (48), Mouse (Murine) (45), Cow (Bovine) (27), Chicken (21), Rabbit (6), Pig (Porcine) (5), Dog (Canine) (4), Xenopus laevis (2), Zebrafish (1)
Applications Western Blotting (WB) (70), ELISA (45), Immunofluorescence (IF) (38), Immunohistochemistry (IHC) (30), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (13), Immunocytochemistry (ICC) (10), Immunoprecipitation (IP) (7), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Frozen Sections) (IHC (fro)) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (6), Internal Region (4), C-Term (3), AA 1-260 (2), Middle Region (1)