Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405111

Potassium Channel, Subfamily V, Member 1 (KCNV1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2700023A03Rik, vibe, Kv8.1, HNKA, KCNB3, KV2.3, KV8.1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405111
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KCNV1 antibody: synthetic peptide directed towards the N terminal of human KCNV1
Sequence ALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAVVVASY RRPGALAAVP
Predicted Reactivity Human : 100%, Mouse : 92%, Rabbit : 92%, Rat : 92%, Bovine : 85%, Dog : 85%, Horse : 85%
Characteristics This is a rabbit polyclonal antibody against KCNV1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KCNV1
Background Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNV1 is a member of the potassium voltage-gated channel subfamily V. This protein is essentially present in the brain, and its role might be to inhibit the function of a particular class of outward rectifier potassium channel types.Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium voltage-gated channel subfamily V. This protein is essentially present in the brain, and its role might be to inhibit the function of a particular class of outward rectifier potassium channel types.
Molecular Weight 56kDa
Gene ID 27012
NCBI Accession NP_055194, NM_014379
UniProt Q6PIU1
Research Area Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KCNV1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gutman, Chandy, Grissmer et al.: "International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels." in: Pharmacological reviews, Vol. 57, Issue 4, pp. 473-508, 2005 (PubMed).

Alternatives for antigen "Potassium Channel, Subfamily V, Member 1 (KCNV1)", type "Antibodies"
Hosts (6)
Reactivities (4), (3)
Applications (6), (4), (3), (1), (1)
Epitopes (4), (2), (1), (1)
Beacon