Nuclear Receptor Subfamily 2, Group C, Member 2 (NR2C2) antibody

Antigen: Nuclear Receptor Subfamily 2, Group C, Member 2 (NR2C2)

Synonyms: TR4, TAK1, TR2R1, hTAK1, Tr4, im:6911408, gb:dq017625

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis, Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN405149

Additional Information

Alternative name: NR2C2

Gene ID: NR2C2

Immunogen: The immunogen for anti-NR2C2 antibody: synthetic peptide directed towards the N terminal of human NR2C2

Sequence: FTSLNKEKIVTDQQTGQKIQIVTAVDASGSPKQQFILTSP DGAGTGKVIL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NR2C2 antibody concentration is 1 mg/ml.

Description: Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes. Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes (Yoshikawa et al., 1996 [PubMed 8661150]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 615 amino acids

Molecular Weight: 67kDa

Application Details

Application Notes: WB Suggested Anti-NR2C2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-NR2C2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain

Publications

Product: Bouwmeester, Bauch, Ruffner et al.: "A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway." in: Nature cell biology, Vol. 6, Issue 2, pp. 97-105, 2004 (PubMed).