TR4 antibody (C-Term)

Catalog No. ABIN630120

The Rabbit Polyclonal anti-TR4 antibody (ABIN630120) specifically detects TR4 in WB and IHC. The antibody is reactive with Human, Rat, Mouse and Dog samples.

Quick Overview for TR4 antibody (C-Term) (ABIN630120)

Target: TR4 (NR2C2) (Nuclear Receptor Subfamily 2, Group C, Member 2 (NR2C2))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TR4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-TR4 Antibody

Binding Specificity: C-Term

Specificity: NR2 C2 antibody was raised against the C terminal of NR2 2

Purification: Purified

Immunogen: NR2 C2 antibody was raised using the C terminal of NR2 2 corresponding to a region with amino acids AQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNS

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NR2C2 Blocking Peptide, (ABIN936831), is also available for use as a blocking control in assays to test for specificity of this NR2C2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TR4

Target: TR4 (NR2C2) (Nuclear Receptor Subfamily 2, Group C, Member 2 (NR2C2))

Alternative Name: NR2C2

Background: Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes.Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: TCR Signaling, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Tube Formation, Toll-Like Receptors Cascades