Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405205

Tripartite Motif Containing 33 (TRIM33) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
ECTO, PTC7, RFG7, TF1G, TIF1G, TIF1GAMMA, TIFGAMMA, 8030451N04Rik, AI413936, Ecto, Tif1g, ectodermin, mKIAA1113, ecto, ptc7, rfg7, tf1g, tif1g, tif1gamma, tifgamma, cb1085, id:ibd2175, mon, wu:fc17f10 ... show more
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405205
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRIM33 antibody: synthetic peptide directed towards the middle region of human TRIM33
Sequence EIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLK SDERPVHIK
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against TRIM33. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TRIM33
Background TRIM33 is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.
Molecular Weight 122kDa
Gene ID 51592
NCBI Accession NP_056990, NM_015906
UniProt Q9UPN9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRIM33 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications He, Dorn, Erdjument-Bromage et al.: "Hematopoiesis controlled by distinct TIF1gamma and Smad4 branches of the TGFbeta pathway." in: Cell, Vol. 125, Issue 5, pp. 929-41, 2006 (PubMed).

Alternatives for antigen "Tripartite Motif Containing 33 (TRIM33)", type "Antibodies"
Hosts (26), (17)
Reactivities (41), (15), (15), (13), (13), (13), (12), (2), (2)
Applications (32), (16), (11), (10), (10), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (3), (3), (3), (2), (2), (2), (1), (1)
Beacon