Did you know that you can buy products from over 140 different suppliers from us?

Tripartite Motif Containing 33 (TRIM33) (Middle Region) antibody

Details for Product No. ABIN405205
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
ECTO, PTC7, RFG7, TF1G, TIF1G, TIF1GAMMA, TIFGAMMA, 8030451N04Rik, AI413936, Ecto, Tif1g, ectodermin, mKIAA1113, ecto, ptc7, rfg7, tf1g, tif1g, tif1gamma, tifgamma, cb1085, id:ibd2175, mon, wu:fc17f10 ... show more
ECTO, PTC7, RFG7, TF1G, TIF1G, TIF1GAMMA, TIFGAMMA, 8030451N04Rik, AI413936, Ecto, Tif1g, ectodermin, mKIAA1113, ecto, ptc7, rfg7, tf1g, tif1g, tif1gamma, tifgamma, cb1085, id:ibd2175, mon, wu:fc17f10, zgc:136680, TRIM33, MGC146665 show less
Epitope
Middle Region
(19), (7), (4), (3), (3), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(53), (14), (14), (13), (13), (12), (12), (6)
Host
Rabbit
(42), (17)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunofluorescence (IF), Western Blotting (WB)
(42), (27), (13), (13), (10), (3), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405205
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TRIM33
Sequence EIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLK SDERPVHIK
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against TRIM33. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TRIM33
Background TRIM33 is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.
Molecular Weight 122 kDa
Gene ID 51592
NCBI Accession NM_015906, NP_056990
UniProt Q9UPN9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1127 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tripartite Motif Containing 33 (TRIM33) (Middle Region) antibody WB Suggested Anti-TRIM33 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Background publications He, Dorn, Erdjument-Bromage et al.: "Hematopoiesis controlled by distinct TIF1gamma and Smad4 branches of the TGFbeta pathway." in: Cell, Vol. 125, Issue 5, pp. 929-41, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405205
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top