Hypoxia Inducible Factor 1, alpha Subunit Inhibitor (HIF1AN) (Middle Region) antibody

Details for Product No. ABIN405217
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms FIH1, 2310046M24Rik, A830014H24Rik, cb728, id:ibd5139, HIF-1a, HIF1a, hif-1a, hif1a
Epitope
Middle Region
(12), (10), (2), (2), (2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Zebrafish (Danio rerio), Cow (Bovine), Human
(64), (31), (29), (14), (14), (12), (12), (1), (1)
Host
Rabbit
(49), (13)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(51), (20), (12), (11), (11), (10), (3), (3), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN405217
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human HIF1AN
Sequence GGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKML GEALGNPQEV
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against HIF1AN. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HIF1AN
Background HIF1AN is a co-repressor that interacts with hypoxia-inducible factor 1 (HIF-1) alpha and the von Hippel-Lindau tumor suppressor protein to mediate repression of HIF-1 transcriptional activity.
Molecular Weight 40 kDa
Gene ID 55662
NCBI Accession NM_017902, NP_060372
UniProt Q9NWT6
Research Area Cancer, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 349 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Jacobs, Hsing, Bain et al.: "Polymorphisms in angiogenesis-related genes and prostate cancer." in: Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology, Vol. 17, Issue 4, pp. 972-7, 2008 (PubMed).

Hosts (49), (13)
Reactivities (64), (31), (29), (14), (14), (12), (12), (1), (1)
Applications (51), (20), (12), (11), (11), (10), (3), (3), (2), (2), (1)
Conjugates (4), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (12), (10), (2), (2), (2), (2)
back to top