Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405217

Hypoxia Inducible Factor 1, alpha Subunit Inhibitor (HIF1AN) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FIH1, 2310046M24Rik, A830014H24Rik, cb728, id:ibd5139, HIF-1a, HIF1a, hif-1a, hif1a
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Zebrafish (Danio rerio), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405217
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HIF1AN antibody: synthetic peptide directed towards the middle region of human HIF1AN
Sequence GGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKML GEALGNPQEV
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against HIF1AN. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HIF1AN
Background HIF1AN is a co-repressor that interacts with hypoxia-inducible factor 1 (HIF-1) alpha and the von Hippel-Lindau tumor suppressor protein to mediate repression of HIF-1 transcriptional activity.
Molecular Weight 40kDa
Gene ID 55662
NCBI Accession NP_060372, NM_017902
UniProt Q9NWT6
Research Area Cancer, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HIF1AN antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Jacobs, Hsing, Bain et al.: "Polymorphisms in angiogenesis-related genes and prostate cancer." in: Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology, Vol. 17, Issue 4, pp. 972-7, 2008 (PubMed).

Alternatives for antigen "Hypoxia Inducible Factor 1, alpha Subunit Inhibitor (HIF1AN)", type "Antibodies"
Hosts (55), (15)
Reactivities (69), (32), (28), (15), (14), (12), (12), (1), (1)
Applications (59), (19), (19), (14), (11), (10), (4), (3), (3), (1), (1)
Conjugates (4), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (13), (10), (3), (2), (2), (2), (2), (1)
Beacon