Did you know that you can buy products from over 140 different suppliers from us?

Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2) (N-Term) antibody

Details for Product No. ABIN405317
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AAG1, DAP5, NAT1, P97, AA589388, DAP-5, E130105L11Rik, Nat1, Natm1, p97, EIF4G2, NAT1B, eif4g2, hm:zeh1307, wu:fa14h01, wu:fb44h01, wu:fb59c06, wu:fc21b05
Epitope
N-Term
(6), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human, Chicken
(59), (26), (19), (2), (2), (1), (1)
Host
Rabbit
(44), (17)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(50), (22), (17), (13), (10), (5), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405317
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human EIF4G2
Sequence PNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVD VYDKRENPLL
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against EIF4G2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EIF4G2
Background Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. EIF4G2 shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3, eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, EIF4G2 functions as a general repressor of translation by forming translationally inactive complexes. Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3, eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
Molecular Weight 102 kDa
Gene ID 1982
NCBI Accession NM_001418, NP_001409
UniProt P78344
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 907 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2) (N-Term) antibody WB Suggested Anti-EIF4G2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
Background publications Nousch, Reed, Bryson-Richardson et al.: "The eIF4G-homolog p97 can activate translation independent of caspase cleavage." in: RNA (New York, N.Y.), Vol. 13, Issue 3, pp. 374-84, 2007 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405317
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top