Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405317

Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AAG1, DAP5, NAT1, P97, AA589388, DAP-5, E130105L11Rik, Nat1, Natm1, p97, EIF4G2, NAT1B, eif4g2, hm:zeh1307, wu:fa14h01, wu:fb44h01, wu:fb59c06, wu:fc21b05
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405317
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EIF4G2 antibody: synthetic peptide directed towards the N terminal of human EIF4G2
Sequence PNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVD VYDKRENPLL
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against EIF4G2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name EIF4G2
Background Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. EIF4G2 shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3, eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, EIF4G2 functions as a general repressor of translation by forming translationally inactive complexes. Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3, eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
Molecular Weight 102kDa
Gene ID 1982
NCBI Accession NP_001409, NM_001418
UniProt P78344
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EIF4G2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nousch, Reed, Bryson-Richardson et al.: "The eIF4G-homolog p97 can activate translation independent of caspase cleavage." in: RNA (New York, N.Y.), Vol. 13, Issue 3, pp. 374-84, 2007 (PubMed).

Alternatives for antigen "Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2)", type "Antibodies"
Hosts (41), (13)
Reactivities (52), (27), (17), (2), (2), (1), (1)
Applications (44), (18), (17), (10), (4), (3), (2), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (2), (1), (1), (1)
Beacon