Did you know that you can buy products from over 140 different suppliers from us?

Heterogeneous Nuclear Ribonucleoprotein R (HNRNPR) (N-Term) antibody

Details for Product No. ABIN405343
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2610003J05Rik, 2610528B01Rik, Hnrpr, HNRPR, hnRNP R, hnRNP-R, hnrpr, wu:fb97a09, wu:fe01h03, zgc:56523
Epitope
N-Term
(9), (7), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
(25), (15), (14), (12), (12), (1)
Host
Rabbit
(26)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(17), (11), (10), (3), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405343
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human HNRNPR
Sequence ANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQK VAERLDEIFQ
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 90 %
Characteristics This is a rabbit polyclonal antibody against HNRNPR. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HNRNPR
Background HNRNPR belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein has three repeats of quasi-RRM domains that bind to RNAs and also contains a nuclear localization motif. Multiple alternatively spliced transcript variants have been found for this gene. This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs and also contains a nuclear localization motif. Multiple alternatively spliced transcript variants have been found for this gene.
Molecular Weight 71 kDa
Gene ID 10236
NCBI Accession NM_005826, NP_005817
UniProt O43390
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 633 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Heterogeneous Nuclear Ribonucleoprotein R (HNRNPR) (N-Term) antibody WB Suggested Anti-HNRNPR Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate
Product cited in: Szafranski, Schindler, Taudien et al.: "Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns." in: Genome biology, Vol. 8, Issue 8, pp. R154, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405343
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top