Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405382

Splicing Factor 4 (SF4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms F23858, RBP, SF4, Sf4, 5730496N02Rik, rbp, sf4, f23858
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405382
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SF4 antibody: synthetic peptide directed towards the middle region of human SF4
Sequence TFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGE GLGSEGQGIK
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against SF4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SF4
Background SF4 is a member of the SURP family of splicing factors. SF4 is a member of the SURP family of splicing factors.
Molecular Weight 72kDa
Gene ID 57794
NCBI Accession NP_757386, NM_172231
UniProt Q8IWZ8
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SF4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Alternatives for antigen "Splicing Factor 4 (SF4)", type "Antibodies"
Hosts (17)
Reactivities (14), (5), (3), (1), (1), (1), (1)
Applications (16), (6)
Epitopes (4), (2), (2), (2), (2), (1), (1)
Beacon